![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein automated matches [190124] (13 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186848] (60 PDB entries) |
![]() | Domain d4v3kd_: 4v3k D: [271277] Other proteins in same PDB: d4v3kb1, d4v3kb2, d4v3ke1, d4v3ke2 automated match to d3a33a_ complexed with cl, edo, zn |
PDB Entry: 4v3k (more details), 2.04 Å
SCOPe Domain Sequences for d4v3kd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v3kd_ d.20.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} alkrihkelndlardppaqcragpvgddmfhwqatimgpndspyqggvffltihfptdyp fkppkvafttriyhpninsngsikldilrsqwspaltiskvllsicsllcdpnpddplvp eiariyktdrekynriarewtqkyam
Timeline for d4v3kd_: