Lineage for d4v3kd_ (4v3k D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2939257Protein automated matches [190124] (13 species)
    not a true protein
  7. 2939272Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries)
  8. 2939316Domain d4v3kd_: 4v3k D: [271277]
    Other proteins in same PDB: d4v3kb1, d4v3kb2, d4v3ke1, d4v3ke2
    automated match to d3a33a_
    complexed with cl, edo, zn

Details for d4v3kd_

PDB Entry: 4v3k (more details), 2.04 Å

PDB Description: rnf38-ubch5b-ub complex
PDB Compounds: (D:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d4v3kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v3kd_ d.20.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkrihkelndlardppaqcragpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsikldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d4v3kd_:

Click to download the PDB-style file with coordinates for d4v3kd_.
(The format of our PDB-style files is described here.)

Timeline for d4v3kd_: