Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries) |
Domain d4v3kb1: 4v3k B:1-76 [271276] Other proteins in same PDB: d4v3ka_, d4v3kb2, d4v3kd_, d4v3ke2 automated match to d3dbhi_ complexed with cl, edo, zn |
PDB Entry: 4v3k (more details), 2.04 Å
SCOPe Domain Sequences for d4v3kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v3kb1 d.15.1.1 (B:1-76) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d4v3kb1:
View in 3D Domains from other chains: (mouse over for more information) d4v3ka_, d4v3kd_, d4v3ke1, d4v3ke2 |