Lineage for d4v2ua1 (4v2u A:2-385)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142456Family c.87.1.9: Sialyltransferase-like [142773] (2 protein domains)
    automatically mapped to Pfam PF11477
  6. 2142473Protein automated matches [190544] (2 species)
    not a true protein
  7. 2142474Species Pasteurella dagmatis [TaxId:754] [271272] (5 PDB entries)
  8. 2142479Domain d4v2ua1: 4v2u A:2-385 [271273]
    Other proteins in same PDB: d4v2ua2
    automated match to d2iy7a_

Details for d4v2ua1

PDB Entry: 4v2u (more details), 2.71 Å

PDB Description: apo-structure of alpha2,3-sialyltransferase from pasteurella dagmatis
PDB Compounds: (A:) sialyltransferase

SCOPe Domain Sequences for d4v2ua1:

Sequence, based on SEQRES records: (download)

>d4v2ua1 c.87.1.9 (A:2-385) automated matches {Pasteurella dagmatis [TaxId: 754]}
tiyldpaslptlnqlmhftkesedketarifgfsrfklpekiteqynnihfveiknnrpt
ediftildqypekleldlhlniahsiqlfhpilqyrfkhpdrisikslnlyddgtmeyvd
lekeenkdiksaikkaekqlsdylltgkinfdnptlaryvwqsqypvkyhflsteyfeka
eflqplktylagkyqkmdwsayeklspeqqtfylklvgfsdetkqlfhteqtkfiftgtt
twegntdireyyakqqlnllkhfthsegdlfigdqykiyfkghprggdindyilkhakdi
tnipanisfeilmmtgllpdkvggvasslyfslpkekishiiftsnkkiknkedalndpy
vrvmlrlgmidksqiifwdslkql

Sequence, based on observed residues (ATOM records): (download)

>d4v2ua1 c.87.1.9 (A:2-385) automated matches {Pasteurella dagmatis [TaxId: 754]}
tiyldpaslptlnqlmhftkesedketarifgfsrlpekiteqynnihfveiknnrpted
iftildqypekleldlhlniahsiqlfhpilqyrfkhpdrisikslnlyddgtmeyvdle
keenkdiksaikkaekqlsdylltgkinfdnptlaryvwqsqypvkyhflsteyfekaef
lqplktylagkyqkmdwsayeklspeqqtfylklvgfsdetkqlfhteqtkfiftgtttw
egntdireyyakqqlnllkhfthsegdlfigdqykiyfkghprggdindyilkhakditn
ipanisfeilmmtgllpdkvggvasslyfslpkekishiiftsnkkiknkedalndpyvr
vmlrlgmidksqiifwdslkql

SCOPe Domain Coordinates for d4v2ua1:

Click to download the PDB-style file with coordinates for d4v2ua1.
(The format of our PDB-style files is described here.)

Timeline for d4v2ua1:

  • d4v2ua1 first appeared in SCOPe 2.05, called d4v2ua_

View in 3D
Domains from same chain:
(mouse over for more information)
d4v2ua2