Lineage for d4uwwa_ (4uww A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235412Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2235413Protein automated matches [190159] (16 species)
    not a true protein
  7. 2235768Species Struthio camelus [TaxId:8801] [271269] (2 PDB entries)
  8. 2235769Domain d4uwwa_: 4uww A: [271270]
    automated match to d1jzna_

Details for d4uwwa_

PDB Entry: 4uww (more details), 1.44 Å

PDB Description: crystallographic structure of the intramineral protein struthicalcin from struthio camelus eggshell
PDB Compounds: (A:) struthiocalcin-1

SCOPe Domain Sequences for d4uwwa_:

Sequence, based on SEQRES records: (download)

>d4uwwa_ d.169.1.0 (A:) automated matches {Struthio camelus [TaxId: 8801]}
dkcpkgwldfrgncygyfryelpwkraeawcrsiragahlasihtseehraiakfisqyh
hgeeeedvwiglfrwnsvwawidgskkhysalddddypkgkhcavldessgflswdndsc
gernafickcta

Sequence, based on observed residues (ATOM records): (download)

>d4uwwa_ d.169.1.0 (A:) automated matches {Struthio camelus [TaxId: 8801]}
dkcpkgwldfrgncygyfryelpwkraeawcrsiragahlasihtseehraiakfisqyh
hgeeeedvwiglfrwnsvwawidgskkhysalddypkgkhcavldessgflswdndscge
rnafickcta

SCOPe Domain Coordinates for d4uwwa_:

Click to download the PDB-style file with coordinates for d4uwwa_.
(The format of our PDB-style files is described here.)

Timeline for d4uwwa_: