Lineage for d4ulvb_ (4ulv B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2312848Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2313237Family a.24.3.0: automated matches [271165] (1 protein)
    not a true family
  6. 2313238Protein automated matches [271167] (4 species)
    not a true protein
  7. 2313246Species Shewanella frigidimarina [TaxId:56812] [271169] (2 PDB entries)
  8. 2313248Domain d4ulvb_: 4ulv B: [271267]
    automated match to d2xlea_
    complexed with gol, hec, so4

Details for d4ulvb_

PDB Entry: 4ulv (more details), 1.29 Å

PDB Description: cytochrome c prime from shewanella frigidimarina
PDB Compounds: (B:) cytochrome c, class II

SCOPe Domain Sequences for d4ulvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ulvb_ a.24.3.0 (B:) automated matches {Shewanella frigidimarina [TaxId: 56812]}
nfeepadaieyrqaafgliaynfgdmgamlkgkkpfdaavfstradnvaalskiphegfi
agsdkgdtealakiwqdkadfdskmtafqdnaaalavaakssdqnnikqafantgksckg
chdvykkd

SCOPe Domain Coordinates for d4ulvb_:

Click to download the PDB-style file with coordinates for d4ulvb_.
(The format of our PDB-style files is described here.)

Timeline for d4ulvb_: