![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
![]() | Family a.24.3.0: automated matches [271165] (1 protein) not a true family |
![]() | Protein automated matches [271167] (4 species) not a true protein |
![]() | Species Shewanella frigidimarina [TaxId:56812] [271169] (2 PDB entries) |
![]() | Domain d4ulvb_: 4ulv B: [271267] automated match to d2xlea_ complexed with gol, hec, so4 |
PDB Entry: 4ulv (more details), 1.29 Å
SCOPe Domain Sequences for d4ulvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ulvb_ a.24.3.0 (B:) automated matches {Shewanella frigidimarina [TaxId: 56812]} nfeepadaieyrqaafgliaynfgdmgamlkgkkpfdaavfstradnvaalskiphegfi agsdkgdtealakiwqdkadfdskmtafqdnaaalavaakssdqnnikqafantgksckg chdvykkd
Timeline for d4ulvb_: