SCOPe 2.05: Domain d4u85a2: 4u85 A:51-163

Lineage for d4u85a2 (4u85 A:51-163)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species)
   Domain 1 is a WW-domain

7. Species Human (Homo sapiens) [TaxId:9606] [54548] (46 PDB entries)

8. Domain d4u85a2: 4u85 A:51-163 [271266]
   Other proteins in same PDB: d4u85a1
   automated match to d3tc5a2
   complexed with 15p

Details for d4u85a2

PDB Entry: 4u85, 1.7 Å

PDB Description: human pin1 with cysteine sulfinic acid 113

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d4u85a2:

Sequence; same for both SEQRES and ATOM records:

>d4u85a2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf
sdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte

Timeline for d4u85a2:

• d4u85a2 is new in SCOPe 2.05-stable
  
• d4u85a2 appears in SCOPe 2.06
  
• d4u85a2 appears in the current release, SCOPe 2.08