SCOPe 2.06: Domain d4u84a1: 4u84 A:7-38

Lineage for d4u84a1 (4u84 A:7-38)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.0: automated matches [227264] (1 protein)
   not a true family

6. Protein automated matches [227055] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226058] (14 PDB entries)

8. Domain d4u84a1: 4u84 A:7-38 [271261]
   Other proteins in same PDB: d4u84a2
   automated match to d1f8ab1
   complexed with 15p

Details for d4u84a1

PDB Entry: 4u84, 1.78 Å

PDB Description: human pin1 with s-hydroxyl-cysteine 113

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d4u84a1:

Sequence; same for both SEQRES and ATOM records:

>d4u84a1 b.72.1.0 (A:7-38) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lppgwekamsrssgrvyyfnhitnasqwerps

Timeline for d4u84a1:

• d4u84a1 first appeared in SCOPe 2.05
  
• d4u84a1 appears in SCOPe 2.07
  
• d4u84a1 appears in the current release, SCOPe 2.08