Lineage for d4u7ya_ (4u7y A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985818Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1986193Superfamily a.7.14: MIT domain [116846] (2 families) (S)
  5. 1986194Family a.7.14.1: MIT domain [116847] (4 proteins)
    Pfam PF04212
    this is a repeat family; one repeat unit is 1wr0 A:5-81 found in domain
  6. 1986207Protein automated matches [271258] (1 species)
    not a true protein
  7. 1986208Species Human (Homo sapiens) [TaxId:9606] [271259] (1 PDB entry)
  8. 1986209Domain d4u7ya_: 4u7y A: [271260]
    automated match to d1wr0a1

Details for d4u7ya_

PDB Entry: 4u7y (more details), 2.5 Å

PDB Description: structure of the complex of vps4b mit and ist1 mim
PDB Compounds: (A:) Vacuolar protein sorting-associated protein 4B

SCOPe Domain Sequences for d4u7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u7ya_ a.7.14.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsira
kcteyldraeklkeylknkekka

SCOPe Domain Coordinates for d4u7ya_:

Click to download the PDB-style file with coordinates for d4u7ya_.
(The format of our PDB-style files is described here.)

Timeline for d4u7ya_: