![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.14: MIT domain [116846] (2 families) ![]() |
![]() | Family a.7.14.1: MIT domain [116847] (4 proteins) Pfam PF04212 this is a repeat family; one repeat unit is 1wr0 A:5-81 found in domain |
![]() | Protein automated matches [271258] (1 species) not a true protein |
![]() | Species Homo sapiens [TaxId:9606] [271259] (1 PDB entry) |
![]() | Domain d4u7ya_: 4u7y A: [271260] automated match to d1wr0a1 |
PDB Entry: 4u7y (more details), 2.5 Å
SCOPe Domain Sequences for d4u7ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u7ya_ a.7.14.1 (A:) automated matches {Homo sapiens [TaxId: 9606]} msstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsira kcteyldraeklkeylknkekka
Timeline for d4u7ya_: