Lineage for d4tw1j_ (4tw1 J:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955986Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 1955987Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 1956115Family f.6.1.0: automated matches [227293] (1 protein)
    not a true family
  6. 1956116Protein automated matches [227114] (4 species)
    not a true protein
  7. 1956129Species Staphylococcus aureus [TaxId:451516] [260976] (1 PDB entry)
  8. 1956139Domain d4tw1j_: 4tw1 J: [271252]
    automated match to d4tw1b_

Details for d4tw1j_

PDB Entry: 4tw1 (more details), 2.8 Å

PDB Description: crystal structure of the octameric pore complex of the staphylococcus aureus bi-component toxin lukgh
PDB Compounds: (J:) Possible leukocidin subunit

SCOPe Domain Sequences for d4tw1j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tw1j_ f.6.1.0 (J:) automated matches {Staphylococcus aureus [TaxId: 451516]}
apddigkngkitkrtetvydektnilqnlqfdfiddptydknvllvkkqgsihsnlkfes
hkeeknsnwlkypseyhvdfqvkrnrkteildqlpknkistakvdstfsyssggkfdstk
gigrtssnsysktisynqqnydtiasgknnnwhvhwsviandlkyggevknrndellfyr
ntriatvenpelsfaskyrypalvrsgfnpefltylsneksnektqfevtytrnqdilkn
rpgihyappileknkdgqrlivtyevdwknktvkvvdkysddnkpyke

SCOPe Domain Coordinates for d4tw1j_:

Click to download the PDB-style file with coordinates for d4tw1j_.
(The format of our PDB-style files is described here.)

Timeline for d4tw1j_: