SCOP 1.73: Domain d1exsa_: 1exs A:

Lineage for d1exsa_ (1exs A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (8 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50829] (1 PDB entry)

8. Domain d1exsa_: 1exs A: [27125]
   CASP4
   complexed with cry, na

Details for d1exsa_

PDB Entry: 1exs, 2.39 Å

PDB Description: structure of porcine beta-lactoglobulin

PDB Compounds: (A:) beta-lactoglobulin

SCOP Domain Sequences for d1exsa_:

Sequence; same for both SEQRES and ATOM records:

>d1exsa_ b.60.1.1 (A:) beta-Lactoglobulin {Pig (Sus scrofa) [TaxId: 9823]}
vevtpimteldtqkvagtwhtvamavsdvslldakssplkayveglkptpegdleillqk
rendkcaqevllakktdipavfkinaldenqlflldtdydshlllcmensaspehslvcq
slartlevddqirekfedalktlsvpmrilpaqleeqcrv

Timeline for d1exsa_:

• d1exsa_ first appeared (with stable ids) in SCOP 1.55
  
• d1exsa_ appears in SCOP 1.71
  
• d1exsa_ appears in SCOP 1.75
  
• d1exsa_ appears in the current release, SCOPe 2.08