SCOPe 2.06: Domain d4tnsb_: 4tns B:

Lineage for d4tnsb_ (4tns B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species)
   Domain 1 is a WW-domain

7. Species Human (Homo sapiens) [TaxId:9606] [54548] (47 PDB entries)

8. Domain d4tnsb_: 4tns B: [271244]
   automated match to d4tyoa_
   complexed with 3kv

Details for d4tnsb_

PDB Entry: 4tns, 1.33 Å

PDB Description: structure of pin1 ppiase domain bound with all-trans retinoic acid

PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d4tnsb_:

Sequence; same for both SEQRES and ATOM records:

>d4tnsb_ d.26.1.1 (B:) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
geparvrcshllvkhsqsrrpsswrqeqitrtqeealelingyiqkiksgeedfeslasq
fsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte

Timeline for d4tnsb_:

• d4tnsb_ first appeared in SCOPe 2.05
  
• d4tnsb_ appears in SCOPe 2.07
  
• d4tnsb_ appears in the current release, SCOPe 2.08