Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species) Domain 1 is a WW-domain |
Species Human (Homo sapiens) [TaxId:9606] [54548] (47 PDB entries) |
Domain d4tnsb_: 4tns B: [271244] automated match to d4tyoa_ complexed with 3kv |
PDB Entry: 4tns (more details), 1.33 Å
SCOPe Domain Sequences for d4tnsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tnsb_ d.26.1.1 (B:) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} geparvrcshllvkhsqsrrpsswrqeqitrtqeealelingyiqkiksgeedfeslasq fsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
Timeline for d4tnsb_: