Lineage for d2rv6a1 (2rv6 A:8-92)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639864Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 2639865Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 2640232Family g.37.1.0: automated matches [196454] (1 protein)
    not a true family
  6. 2640233Protein automated matches [196455] (4 species)
    not a true protein
  7. 2640238Species Human (Homo sapiens) [TaxId:9606] [255137] (6 PDB entries)
  8. 2640239Domain d2rv6a1: 2rv6 A:8-92 [271234]
    Other proteins in same PDB: d2rv6a2
    automated match to d2rsja_
    complexed with zn

Details for d2rv6a1

PDB Entry: 2rv6 (more details)

PDB Description: solution structures of the dna-binding domains (zf2-zf3-zf4) of immune-related zinc-finger protein zfat
PDB Compounds: (A:) Zinc finger protein ZFAT

SCOPe Domain Sequences for d2rv6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rv6a1 g.37.1.0 (A:8-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kiftceycnkvfkfkhslqahlrihtnekpykcpqcsyasaikanlnvhlrkhtgekfac
dycsftclskghlkvhiervhkkik

SCOPe Domain Coordinates for d2rv6a1:

Click to download the PDB-style file with coordinates for d2rv6a1.
(The format of our PDB-style files is described here.)

Timeline for d2rv6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rv6a2