![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
![]() | Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
![]() | Family g.37.1.0: automated matches [196454] (1 protein) not a true family |
![]() | Protein automated matches [196455] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255137] (6 PDB entries) |
![]() | Domain d2rv6a1: 2rv6 A:8-92 [271234] Other proteins in same PDB: d2rv6a2 automated match to d2rsja_ complexed with zn |
PDB Entry: 2rv6 (more details)
SCOPe Domain Sequences for d2rv6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rv6a1 g.37.1.0 (A:8-92) automated matches {Human (Homo sapiens) [TaxId: 9606]} kiftceycnkvfkfkhslqahlrihtnekpykcpqcsyasaikanlnvhlrkhtgekfac dycsftclskghlkvhiervhkkik
Timeline for d2rv6a1: