SCOPe 2.08: Domain d2rv6a1: 2rv6 A:8-92

Lineage for d2rv6a1 (2rv6 A:8-92)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.0: automated matches [196454] (1 protein)
   not a true family

6. Protein automated matches [196455] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255137] (6 PDB entries)

8. Domain d2rv6a1: 2rv6 A:8-92 [271234]
   Other proteins in same PDB: d2rv6a2
   automated match to d2rsja_
   complexed with zn

Details for d2rv6a1

PDB Entry: 2rv6

PDB Description: solution structures of the dna-binding domains (zf2-zf3-zf4) of immune-related zinc-finger protein zfat

PDB Compounds: (A:) Zinc finger protein ZFAT

SCOPe Domain Sequences for d2rv6a1:

Sequence; same for both SEQRES and ATOM records:

>d2rv6a1 g.37.1.0 (A:8-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kiftceycnkvfkfkhslqahlrihtnekpykcpqcsyasaikanlnvhlrkhtgekfac
dycsftclskghlkvhiervhkkik

Timeline for d2rv6a1:

• d2rv6a1 first appeared in SCOPe 2.05, called d2rv6a_
  
• d2rv6a1 appears in SCOPe 2.07