Lineage for d4rs0a2 (4rs0 A:74-588)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002843Family a.93.1.2: Myeloperoxidase-like [48132] (3 protein domains)
  6. 2002863Protein Prostaglandin H2 synthase [48136] (2 species)
    contains EGF-like module
  7. 2002864Species Mouse (Mus musculus) [TaxId:10090] [48138] (12 PDB entries)
  8. 2002897Domain d4rs0a2: 4rs0 A:74-588 [271231]
    Other proteins in same PDB: d4rs0a1
    automated match to d1cvua1
    complexed with bog, ibp, nag

Details for d4rs0a2

PDB Entry: 4rs0 (more details), 2.81 Å

PDB Description: crystal structure of murine h90w cyclooxygenase-2 complexed with s- ibuprofen
PDB Compounds: (A:) Prostaglandin G/H synthase 2

SCOPe Domain Sequences for d4rs0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rs0a2 a.93.1.2 (A:74-588) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]}
fltriklllkptpntvwyilthfkgvwnivnnipflrslimkyvltsrsylidspptynv
hygyksweafsnlsyytralppvaddcptpmgvkgnkelpdskevlekvllrrefipdpq
gsnmmfaffaqhfthqffktdhkrgpgftrglghgvdlnhiygetldrqhklrlfkdgkl
kyqviggevypptvkdtqvemiypphipenlqfavgqevfglvpglmmyatiwlrehnrv
cdilkqehpewgdeqlfqtsrliligetikiviedyvqhlsgyhfklkfdpellfnqqfq
yqnriasefntlyhwhpllpdtfniedqeysfkqflynnsillehgltqfvesftrqiag
rvaggrnvpiavqavakasidqsremkyqslneyrkrfslkpytsfeeltgekemaaelk
alysdidvmelypallvekprpdaifgetmvelgapfslkglmgnpicspqywkpstfgg
evgfkiintasiqslicnnvkgcpftsfnvqdpqpt

SCOPe Domain Coordinates for d4rs0a2:

Click to download the PDB-style file with coordinates for d4rs0a2.
(The format of our PDB-style files is described here.)

Timeline for d4rs0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rs0a1