Lineage for d4r43a2 (4r43 A:245-606)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912052Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2912053Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2912198Family c.91.1.0: automated matches [196141] (1 protein)
    not a true family
  6. 2912199Protein automated matches [196142] (6 species)
    not a true protein
  7. 2912233Species Mycobacterium tuberculosis [TaxId:83332] [271220] (3 PDB entries)
  8. 2912234Domain d4r43a2: 4r43 A:245-606 [271221]
    Other proteins in same PDB: d4r43a1
    automated match to d4wiua2
    complexed with gdp, mn, peg, po4

Details for d4r43a2

PDB Entry: 4r43 (more details), 1.8 Å

PDB Description: crystal structure analysis of mtb pepck
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d4r43a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r43a2 c.91.1.0 (A:245-606) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
wlaehmlilklispenkayyfaaafpsacgktnlamlqptipgwraetlgddiawmrfgk
dgrlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweglegdpq
hlidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrrktt
vplvteardwqhgvfigatlgseqtaaaegkvgnvrrdpmamlpflgynvgdyfqhwinl
gkhadesklpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvp
avedldldgldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalker
lg

SCOPe Domain Coordinates for d4r43a2:

Click to download the PDB-style file with coordinates for d4r43a2.
(The format of our PDB-style files is described here.)

Timeline for d4r43a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4r43a1