![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
![]() | Protein beta-Lactoglobulin [50827] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50828] (77 PDB entries) Uniprot P02754 |
![]() | Domain d1bsoa_: 1bso A: [27122] complexed with brc |
PDB Entry: 1bso (more details), 2.23 Å
SCOPe Domain Sequences for d1bsoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bsoa_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]} livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
Timeline for d1bsoa_: