Lineage for d1bsoa_ (1bso A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1799772Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1799795Protein beta-Lactoglobulin [50827] (4 species)
  7. 1799796Species Cow (Bos taurus) [TaxId:9913] [50828] (44 PDB entries)
    Uniprot P02754
  8. 1799815Domain d1bsoa_: 1bso A: [27122]
    complexed with brc

Details for d1bsoa_

PDB Entry: 1bso (more details), 2.23 Å

PDB Description: 12-bromododecanoic acid binds inside the calyx of bovine beta-lactoglobulin
PDB Compounds: (A:) protein (bovine beta-lactoglobulin a)

SCOPe Domain Sequences for d1bsoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsoa_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOPe Domain Coordinates for d1bsoa_:

Click to download the PDB-style file with coordinates for d1bsoa_.
(The format of our PDB-style files is described here.)

Timeline for d1bsoa_: