Lineage for d4qlrb1 (4qlr B:2-122)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (19 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (145 PDB entries)
  8. 2347723Domain d4qlrb1: 4qlr B:2-122 [271214]
    Other proteins in same PDB: d4qlra2, d4qlrb2
    automated match to d4tvsa_

Details for d4qlrb1

PDB Entry: 4qlr (more details), 1.7 Å

PDB Description: llama nanobody n02 raised against eaec t6ss tssm
PDB Compounds: (B:) Llama nanobody n02 VH domain

SCOPe Domain Sequences for d4qlrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qlrb1 b.1.1.1 (B:2-122) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvhpggslrlscaasgrtfsdyalgwfrqapgkdrefvaaiswsggstyya
dsvqgrftisrdndknsvylqmnslkpedtavyycaadkyytgpggesvydywgrgtqvt
v

SCOPe Domain Coordinates for d4qlrb1:

Click to download the PDB-style file with coordinates for d4qlrb1.
(The format of our PDB-style files is described here.)

Timeline for d4qlrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qlrb2