SCOPe 2.07: Domain d4qgyb1: 4qgy B:1-128

Lineage for d4qgyb1 (4qgy B:1-128)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d4qgyb1: 4qgy B:1-128 [271211]
   Other proteins in same PDB: d4qgya2, d4qgyb2
   automated match to d4grwe_

Details for d4qgyb1

PDB Entry: 4qgy, 1.38 Å

PDB Description: camelid (llama) nanobody n25 (vhh) against type 6 secretion system tssm protein

PDB Compounds: (B:) nanobody n25, VH domain

SCOPe Domain Sequences for d4qgyb1:

Sequence, based on SEQRES records:

>d4qgyb1 b.1.1.1 (B:1-128) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasgftfedyaigwfrqapgkeregvscisnldgstyy
pdsvkgrftassdkaknmvylqmnslkpedtavyycaavnaqgiyctdyiigpygmdywg
kgtqvtvs

Sequence, based on observed residues (ATOM records):

>d4qgyb1 b.1.1.1 (B:1-128) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasgftfedyaigwfrqapgkeregvscisnldgstyy
pdsvkgrftassdkaknmvylqmnslkpedtavyycaavnaqctdyiigpygmdywgkgt
qvtvs

Timeline for d4qgyb1:

• d4qgyb1 first appeared in SCOPe 2.05, called d4qgyb_
  
• d4qgyb1 appears in SCOPe 2.06
  
• d4qgyb1 appears in the current release, SCOPe 2.08