SCOPe 2.05: Domain d4qgyb_: 4qgy B:

Lineage for d4qgyb_ (4qgy B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries)

8. Domain d4qgyb_: 4qgy B: [271211]
   automated match to d4grwe_

Details for d4qgyb_

PDB Entry: 4qgy, 1.38 Å

PDB Description: camelid (llama) nanobody n25 (vhh) against type 6 secretion system tssm protein

PDB Compounds: (B:) nanobody n25, VH domain

SCOPe Domain Sequences for d4qgyb_:

Sequence, based on SEQRES records:

>d4qgyb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasgftfedyaigwfrqapgkeregvscisnldgstyy
pdsvkgrftassdkaknmvylqmnslkpedtavyycaavnaqgiyctdyiigpygmdywg
kgtqvtvss

Sequence, based on observed residues (ATOM records):

>d4qgyb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasgftfedyaigwfrqapgkeregvscisnldgstyy
pdsvkgrftassdkaknmvylqmnslkpedtavyycaavnaqctdyiigpygmdywgkgt
qvtvss

Timeline for d4qgyb_:

• d4qgyb_ is new in SCOPe 2.05-stable
  
• d4qgyb_ is called d4qgyb1 in SCOPe 2.06
  
• d4qgyb_ appears in the current release, SCOPe 2.08, called d4qgyb1