Lineage for d4qgyb1 (4qgy B:1-128)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020007Species Llama (Lama glama) [TaxId:9844] [187485] (137 PDB entries)
  8. 2020033Domain d4qgyb1: 4qgy B:1-128 [271211]
    Other proteins in same PDB: d4qgya2, d4qgyb2
    automated match to d4grwe_

Details for d4qgyb1

PDB Entry: 4qgy (more details), 1.38 Å

PDB Description: camelid (llama) nanobody n25 (vhh) against type 6 secretion system tssm protein
PDB Compounds: (B:) nanobody n25, VH domain

SCOPe Domain Sequences for d4qgyb1:

Sequence, based on SEQRES records: (download)

>d4qgyb1 b.1.1.1 (B:1-128) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasgftfedyaigwfrqapgkeregvscisnldgstyy
pdsvkgrftassdkaknmvylqmnslkpedtavyycaavnaqgiyctdyiigpygmdywg
kgtqvtvs

Sequence, based on observed residues (ATOM records): (download)

>d4qgyb1 b.1.1.1 (B:1-128) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasgftfedyaigwfrqapgkeregvscisnldgstyy
pdsvkgrftassdkaknmvylqmnslkpedtavyycaavnaqctdyiigpygmdywgkgt
qvtvs

SCOPe Domain Coordinates for d4qgyb1:

Click to download the PDB-style file with coordinates for d4qgyb1.
(The format of our PDB-style files is described here.)

Timeline for d4qgyb1:

  • d4qgyb1 first appeared in SCOPe 2.05, called d4qgyb_

View in 3D
Domains from same chain:
(mouse over for more information)
d4qgyb2