SCOP 1.75: Domain d1b0oa_: 1b0o A:

Lineage for d1b0oa_ (1b0o A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (9 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (21 PDB entries)
   Uniprot P02754

8. Domain d1b0oa_: 1b0o A: [27121]
   complexed with plm

Details for d1b0oa_

PDB Entry: 1b0o, 2.5 Å

PDB Description: bovine beta-lactoglobulin complexed with palmitate, lattice z

PDB Compounds: (A:) beta-lactoglobulin

SCOP Domain Sequences for d1b0oa_:

Sequence; same for both SEQRES and ATOM records:

>d1b0oa_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
lvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

Timeline for d1b0oa_:

• d1b0oa_ first appeared (with stable ids) in SCOP 1.55, called d1b0o__
  
• d1b0oa_ appears in SCOP 1.73
  
• d1b0oa_ appears in SCOPe 2.01
  
• d1b0oa_ appears in the current release, SCOPe 2.08