Lineage for d4pp1e1 (4pp1 E:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761026Domain d4pp1e1: 4pp1 E:1-106 [271203]
    Other proteins in same PDB: d4pp1c2, d4pp1e2
    automated match to d2v7ha1
    complexed with ca, edo, nag, po4

Details for d4pp1e1

PDB Entry: 4pp1 (more details), 3 Å

PDB Description: the crystal structure of der p 1 allergen complexed with fab fragment of mab 5h8
PDB Compounds: (E:) light chain of Fab fragment of mAb 5H8

SCOPe Domain Sequences for d4pp1e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pp1e1 b.1.1.0 (E:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqditnylnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltisnleqediatyfcqqgktlptfgggtkleik

SCOPe Domain Coordinates for d4pp1e1:

Click to download the PDB-style file with coordinates for d4pp1e1.
(The format of our PDB-style files is described here.)

Timeline for d4pp1e1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pp1e2