Lineage for d2blga_ (2blg A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805867Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 805868Superfamily b.60.1: Lipocalins [50814] (9 families) (S)
    bind hydrophobic ligands in their interior
  5. 805869Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
    barrel, closed; n=8, S=12, meander
  6. 805892Protein beta-Lactoglobulin [50827] (3 species)
  7. 805893Species Cow (Bos taurus) [TaxId:9913] [50828] (21 PDB entries)
    Uniprot P02754
  8. 805901Domain d2blga_: 2blg A: [27120]

Details for d2blga_

PDB Entry: 2blg (more details), 2.46 Å

PDB Description: structural basis of the tanford transition of bovine beta- lactoglobulin from crystal structures at three ph values; ph 8.2
PDB Compounds: (A:) beta-lactoglobulin

SCOP Domain Sequences for d2blga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2blga_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOP Domain Coordinates for d2blga_:

Click to download the PDB-style file with coordinates for d2blga_.
(The format of our PDB-style files is described here.)

Timeline for d2blga_: