Lineage for d2blg__ (2blg -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins) 
Protein beta-Lactoglobulin [50827] (2 species) Species Cow (Bos taurus) [TaxId:9913] [50828] (9 PDB entries) 
Domain d2blg__: 2blg - [27120]
Details for d2blg__
PDB Entry: 2blg (more details), 2.46 Å
PDB Description: structural basis of the tanford transition of bovine beta- lactoglobulin from crystal structures at three ph values; ph 8.2
SCOP Domain Sequences for d2blg__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2blg__ b.60.1.1 (-) beta-Lactoglobulin {Cow (Bos taurus)}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
SCOP Domain Coordinates for d2blg__:
Click to download the PDB-style file with coordinates for d2blg__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2blg__:
- d2blg__ appears in SCOP 1.57
- d2blg__ appears in the current release, SCOPe 2.08, called d2blga_
View in 3D