Lineage for d4q1la_ (4q1l A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1917836Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 1917872Protein automated matches [190837] (3 species)
    not a true protein
  7. 1917873Species Bothrops leucurus [TaxId:157295] [271195] (1 PDB entry)
  8. 1917874Domain d4q1la_: 4q1l A: [271198]
    automated match to d2w15a_
    complexed with act, ca, edo, zn

Details for d4q1la_

PDB Entry: 4q1l (more details), 1.9 Å

PDB Description: crystal structure of leucurolysin-a complexed with an endogenous tripeptide (qsw).
PDB Compounds: (A:) Snake venom metalloproteinase leucurolysin-A

SCOPe Domain Sequences for d4q1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q1la_ d.92.1.9 (A:) automated matches {Bothrops leucurus [TaxId: 157295]}
qqfspryielvvvadhgmfkkynsnlntirkwvhemlntvngffrsmnvdaslvnlevws
kkdlikvekdssktltsfgewrerdllprishdhaqlltvivfdeetigiaytagmcdls
qsvavvmdhskknlrvavtmahelghnlgmrhdgnqchcnapscimadtlskglsfefsd
csqnqyqtyltkhnpqcilnkp

SCOPe Domain Coordinates for d4q1la_:

Click to download the PDB-style file with coordinates for d4q1la_.
(The format of our PDB-style files is described here.)

Timeline for d4q1la_: