SCOPe 2.07: Domain d4pt6b_: 4pt6 B:

Lineage for d4pt6b_ (4pt6 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
   automatically mapped to Pfam PF00754

6. Protein automated matches [190377] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187224] (7 PDB entries)

8. Domain d4pt6b_: 4pt6 B: [271197]
   automated match to d1d7pm_

Details for d4pt6b_

PDB Entry: 4pt6, 2.1 Å

PDB Description: the discobody: an engineered discoidin domain from factor viii that binds v 3 integrin with antibody-like affinities

PDB Compounds: (B:) coagulation factor viii

SCOPe Domain Sequences for d4pt6b_:

Sequence, based on SEQRES records:

>d4pt6b_ b.18.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smplgmeskaisdaqitassyacrgdtcwspskarlhlqgrsnawrpqvnnpkewlqvdf
qktmkvtgvttqgvksaatsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpvv
nsldpplltrylrihpqswvhqialrmevlgcea

Sequence, based on observed residues (ATOM records):

>d4pt6b_ b.18.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smplgmeskaisdaqitassyacrgdtcwspskarlhlqgrsnawrpqvnnpkewlqvdf
qktmkvtgvttqgvksaatsmyvkeflisssqdghqwtlffngkvkvfqgnqdsftpvvn
sldpplltrylrihpqswvhqialrmevlgcea

Timeline for d4pt6b_:

• d4pt6b_ first appeared in SCOPe 2.05
  
• d4pt6b_ appears in SCOPe 2.06
  
• d4pt6b_ appears in the current release, SCOPe 2.08