Lineage for d4pt6b_ (4pt6 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774124Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
    automatically mapped to Pfam PF00754
  6. 2774165Protein automated matches [190377] (2 species)
    not a true protein
  7. 2774166Species Human (Homo sapiens) [TaxId:9606] [187224] (7 PDB entries)
  8. 2774172Domain d4pt6b_: 4pt6 B: [271197]
    automated match to d1d7pm_

Details for d4pt6b_

PDB Entry: 4pt6 (more details), 2.1 Å

PDB Description: the discobody: an engineered discoidin domain from factor viii that binds v 3 integrin with antibody-like affinities
PDB Compounds: (B:) coagulation factor viii

SCOPe Domain Sequences for d4pt6b_:

Sequence, based on SEQRES records: (download)

>d4pt6b_ b.18.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smplgmeskaisdaqitassyacrgdtcwspskarlhlqgrsnawrpqvnnpkewlqvdf
qktmkvtgvttqgvksaatsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpvv
nsldpplltrylrihpqswvhqialrmevlgcea

Sequence, based on observed residues (ATOM records): (download)

>d4pt6b_ b.18.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smplgmeskaisdaqitassyacrgdtcwspskarlhlqgrsnawrpqvnnpkewlqvdf
qktmkvtgvttqgvksaatsmyvkeflisssqdghqwtlffngkvkvfqgnqdsftpvvn
sldpplltrylrihpqswvhqialrmevlgcea

SCOPe Domain Coordinates for d4pt6b_:

Click to download the PDB-style file with coordinates for d4pt6b_.
(The format of our PDB-style files is described here.)

Timeline for d4pt6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4pt6a_