SCOPe 2.07: Domain d4pp2a1: 4pp2 A:1-107

Lineage for d4pp2a1 (4pp2 A:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d4pp2a1: 4pp2 A:1-107 [271191]
   Other proteins in same PDB: d4pp2a2, d4pp2c2
   automated match to d2v7ha1
   complexed with ca, nag

Details for d4pp2a1

PDB Entry: 4pp2, 2.74 Å

PDB Description: the crystal structure of der p 1 allergen complexed with fab fragment of mab 10b9

PDB Compounds: (A:) light chain of Fab fragment of 10B9 antibody

SCOPe Domain Sequences for d4pp2a1:

Sequence; same for both SEQRES and ATOM records:

>d4pp2a1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdgitiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltisnleqediatyfcqqgntlpytfgggtkleik

Timeline for d4pp2a1:

• d4pp2a1 first appeared in SCOPe 2.05
  
• d4pp2a1 appears in SCOPe 2.06
  
• d4pp2a1 appears in the current release, SCOPe 2.08