SCOP 1.71: Domain d3blg__: 3blg -

Lineage for d3blg__ (3blg -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (5 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (19 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (16 PDB entries)

8. Domain d3blg__: 3blg - [27119]

Details for d3blg__

PDB Entry: 3blg, 2.56 Å

PDB Description: structural basis of the tanford transition of bovine beta-lactoglobulin from crystal structures at three ph values; ph 6.2

SCOP Domain Sequences for d3blg__:

Sequence; same for both SEQRES and ATOM records:

>d3blg__ b.60.1.1 (-) beta-Lactoglobulin {Cow (Bos taurus)}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

Timeline for d3blg__:

• d3blg__ first appeared (with stable ids) in SCOP 1.55
  
• d3blg__ appears in SCOP 1.69
  
• d3blg__ is called d3blga_ in SCOP 1.73
  
• d3blg__ appears in the current release, SCOPe 2.08, called d3blga_