Lineage for d3blg__ (3blg -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16457Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins)
  6. 16458Protein beta-Lactoglobulin [50827] (2 species)
  7. 16459Species Cow (Bos taurus) [TaxId:9913] [50828] (9 PDB entries)
  8. 16465Domain d3blg__: 3blg - [27119]

Details for d3blg__

PDB Entry: 3blg (more details), 2.56 Å

PDB Description: structural basis of the tanford transition of bovine beta-lactoglobulin from crystal structures at three ph values; ph 6.2

SCOP Domain Sequences for d3blg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3blg__ b.60.1.1 (-) beta-Lactoglobulin {Cow (Bos taurus)}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOP Domain Coordinates for d3blg__:

Click to download the PDB-style file with coordinates for d3blg__.
(The format of our PDB-style files is described here.)

Timeline for d3blg__: