SCOPe 2.08: Domain d3blga_: 3blg A:

Lineage for d3blga_ (3blg A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (76 PDB entries)
   Uniprot P02754

8. Domain d3blga_: 3blg A: [27119]

Details for d3blga_

PDB Entry: 3blg, 2.56 Å

PDB Description: structural basis of the tanford transition of bovine beta-lactoglobulin from crystal structures at three ph values; ph 6.2

PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d3blga_:

Sequence; same for both SEQRES and ATOM records:

>d3blga_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

Timeline for d3blga_:

• d3blga_ first appeared (with stable ids) in SCOP 1.55, called d3blg__
  
• d3blga_ appears in SCOPe 2.07