Lineage for d4pqea_ (4pqe A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2474357Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2474358Protein Acetylcholinesterase [53476] (5 species)
  7. 2474370Species Human (Homo sapiens) [TaxId:9606] [53480] (16 PDB entries)
  8. 2474398Domain d4pqea_: 4pqe A: [271186]
    automated match to d2xupa_

Details for d4pqea_

PDB Entry: 4pqe (more details), 2.9 Å

PDB Description: crystal structure of human acetylcholinesterase
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d4pqea_:

Sequence, based on SEQRES records: (download)

>d4pqea_ c.69.1.1 (A:) Acetylcholinesterase {Human (Homo sapiens) [TaxId: 9606]}
daellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvdatt
fqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygggfy
sgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqwvq
envaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmgea
rrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvvd
gdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvr
vgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgar
vyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfa
rtgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpklls

Sequence, based on observed residues (ATOM records): (download)

>d4pqea_ c.69.1.1 (A:) Acetylcholinesterase {Human (Homo sapiens) [TaxId: 9606]}
daellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvdatt
fqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygggfy
sgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqwvq
envaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmgea
rrratqlahlvgcpndtelvaclrtrpaqvlvnhewhvlsvfrfsfvpvvdgdflsdtpe
alinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvrvgvpqvsdl
aaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgarvyayvfehr
astlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfartgdpnepr
dpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpklls

SCOPe Domain Coordinates for d4pqea_:

Click to download the PDB-style file with coordinates for d4pqea_.
(The format of our PDB-style files is described here.)

Timeline for d4pqea_: