Lineage for d4pqda_ (4pqd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3002785Fold d.170: SRCR-like [56486] (2 superfamilies)
    unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta
  4. 3002825Superfamily d.170.2: A heparin-binding domain [56491] (1 family) (S)
    automatically mapped to Pfam PF02177
  5. 3002826Family d.170.2.1: A heparin-binding domain [56492] (2 proteins)
  6. 3002830Protein automated matches [257780] (1 species)
    not a true protein
  7. 3002831Species Human (Homo sapiens) [TaxId:9606] [257781] (2 PDB entries)
  8. 3002832Domain d4pqda_: 4pqd A: [271185]
    automated match to d4jfna_

Details for d4pqda_

PDB Entry: 4pqd (more details), 1.33 Å

PDB Description: the longer crystal structure of the grow factor like domain from beta amypoid precusor protein (app22-126)
PDB Compounds: (A:) amyloid beta a4 protein

SCOPe Domain Sequences for d4pqda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pqda_ d.170.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdgnagllaepqiamfcgrlnmhmnvqngkwdsdpsgtktcidtkegilqycqevypelq
itnvveanqpvtiqnwckrgrkqckthphfvipyrclvgefvsda

SCOPe Domain Coordinates for d4pqda_:

Click to download the PDB-style file with coordinates for d4pqda_.
(The format of our PDB-style files is described here.)

Timeline for d4pqda_: