Lineage for d4ornb_ (4orn B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1898885Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1899146Protein automated matches [190406] (16 species)
    not a true protein
  7. 1899314Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (40 PDB entries)
  8. 1899366Domain d4ornb_: 4orn B: [271182]
    automated match to d3ztfa_
    complexed with cl, mes, so4

Details for d4ornb_

PDB Entry: 4orn (more details), 1.71 Å

PDB Description: blue fluorescent protein mkalama1
PDB Compounds: (B:) mKalama1

SCOPe Domain Sequences for d4ornb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ornb_ d.22.1.1 (B:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilvemdgdvngrkfsvrgvgegdathgkltlkfictsgklpvpwptlv
ttlsygvqcfsrypdhmkqhdffksampegyvqertiffkddgsyktraevkfegdtlvn
rivlkgtdfkedgnilghkleynmnvgnvyitadkqkngikanfeirhnvedggvqladh
yqqntpigdgsvllpdnhylsvqvklskdpnekrdhmvllefrtaagitpg

SCOPe Domain Coordinates for d4ornb_:

Click to download the PDB-style file with coordinates for d4ornb_.
(The format of our PDB-style files is described here.)

Timeline for d4ornb_: