Lineage for d2mh8a_ (2mh8 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724803Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1724804Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 1724881Family a.8.1.0: automated matches [254234] (1 protein)
    not a true family
  6. 1724882Protein automated matches [254530] (2 species)
    not a true protein
  7. 1724885Species Streptococcus dysgalactiae [TaxId:1334] [271179] (1 PDB entry)
  8. 1724886Domain d2mh8a_: 2mh8 A: [271180]
    automated match to d2fs1a_

Details for d2mh8a_

PDB Entry: 2mh8 (more details)

PDB Description: ga-79-mbp cs-rosetta structures
PDB Compounds: (A:) GA-79-MBP, maltose binding protein

SCOPe Domain Sequences for d2mh8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mh8a_ a.8.1.0 (A:) automated matches {Streptococcus dysgalactiae [TaxId: 1334]}
ngdkgynglaeakekaikdlkiygigehyikliekakqvaavedlkdeilkahdrf

SCOPe Domain Coordinates for d2mh8a_:

Click to download the PDB-style file with coordinates for d2mh8a_.
(The format of our PDB-style files is described here.)

Timeline for d2mh8a_: