Class a: All alpha proteins [46456] (286 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) |
Family a.8.1.0: automated matches [254234] (1 protein) not a true family |
Protein automated matches [254530] (2 species) not a true protein |
Species Streptococcus dysgalactiae [TaxId:1334] [271179] (1 PDB entry) |
Domain d2mh8a_: 2mh8 A: [271180] automated match to d2fs1a_ |
PDB Entry: 2mh8 (more details)
SCOPe Domain Sequences for d2mh8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mh8a_ a.8.1.0 (A:) automated matches {Streptococcus dysgalactiae [TaxId: 1334]} ngdkgynglaeakekaikdlkiygigehyikliekakqvaavedlkdeilkahdrf
Timeline for d2mh8a_: