SCOPe 2.05: Domain d1bsqa_: 1bsq A:

Lineage for d1bsqa_ (1bsq A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (44 PDB entries)
   Uniprot P02754

8. Domain d1bsqa_: 1bsq A: [27118]
   mutant

Details for d1bsqa_

PDB Entry: 1bsq, 2.22 Å

PDB Description: structural and functional consequences of point mutations of variants a and b of bovine beta-lactoglobulin

PDB Compounds: (A:) protein (beta-lactoglobulin)

SCOPe Domain Sequences for d1bsqa_:

Sequence; same for both SEQRES and ATOM records:

>d1bsqa_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

Timeline for d1bsqa_:

• d1bsqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1bsqa_ appears in SCOPe 2.04
  
• d1bsqa_ appears in SCOPe 2.06
  
• d1bsqa_ appears in the current release, SCOPe 2.08