Lineage for d1bsqa_ (1bsq A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378568Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 378569Superfamily b.60.1: Lipocalins [50814] (5 families) (S)
    bind hydrophobic ligands in their interior
  5. 378570Family b.60.1.1: Retinol binding protein-like [50815] (18 proteins)
    barrel, closed; n=8, S=12, meander
  6. 378593Protein beta-Lactoglobulin [50827] (2 species)
  7. 378594Species Cow (Bos taurus) [TaxId:9913] [50828] (15 PDB entries)
  8. 378601Domain d1bsqa_: 1bsq A: [27118]
    mutant

Details for d1bsqa_

PDB Entry: 1bsq (more details), 2.22 Å

PDB Description: structural and functional consequences of point mutations of variants a and b of bovine beta-lactoglobulin

SCOP Domain Sequences for d1bsqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsqa_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus)}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOP Domain Coordinates for d1bsqa_:

Click to download the PDB-style file with coordinates for d1bsqa_.
(The format of our PDB-style files is described here.)

Timeline for d1bsqa_: