Lineage for d1bsqa_ (1bsq A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62088Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 62089Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 62090Family b.60.1.1: Retinol binding protein-like [50815] (14 proteins)
  6. 62103Protein beta-Lactoglobulin [50827] (2 species)
  7. 62104Species Cow (Bos taurus) [TaxId:9913] [50828] (11 PDB entries)
  8. 62110Domain d1bsqa_: 1bsq A: [27118]

Details for d1bsqa_

PDB Entry: 1bsq (more details), 2.22 Å

PDB Description: structural and functional consequences of point mutations of variants a and b of bovine beta-lactoglobulin

SCOP Domain Sequences for d1bsqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsqa_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus)}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOP Domain Coordinates for d1bsqa_:

Click to download the PDB-style file with coordinates for d1bsqa_.
(The format of our PDB-style files is described here.)

Timeline for d1bsqa_: