Lineage for d1bsqa_ (1bsq A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins) 
Protein beta-Lactoglobulin [50827] (2 species) Species Cow (Bos taurus) [TaxId:9913] [50828] (9 PDB entries) 
Domain d1bsqa_: 1bsq A: [27118]
Details for d1bsqa_
PDB Entry: 1bsq (more details), 2.22 Å
PDB Description: structural and functional consequences of point mutations of variants a and b of bovine beta-lactoglobulin
SCOP Domain Sequences for d1bsqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bsqa_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus)}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
SCOP Domain Coordinates for d1bsqa_:
Click to download the PDB-style file with coordinates for d1bsqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bsqa_:
- d1bsqa_ appears in SCOP 1.57
- d1bsqa_ appears in the current release, SCOPe 2.08
View in 3D