Lineage for d2mg4b1 (2mg4 B:1-58)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692770Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [271176] (2 PDB entries)
  8. 2692773Domain d2mg4b1: 2mg4 B:1-58 [271178]
    Other proteins in same PDB: d2mg4a2, d2mg4b2
    automated match to d3zoba_

Details for d2mg4b1

PDB Entry: 2mg4 (more details)

PDB Description: computational design and experimental verification of a symmetric protein homodimer
PDB Compounds: (B:) Computational designed homodimer

SCOPe Domain Sequences for d2mg4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mg4b1 a.4.1.0 (B:1-58) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mekrprtefseeqkkaldlafyfdrrltpewrrylsqrlglneeqierwfrrkeqqig

SCOPe Domain Coordinates for d2mg4b1:

Click to download the PDB-style file with coordinates for d2mg4b1.
(The format of our PDB-style files is described here.)

Timeline for d2mg4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mg4b2