![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
![]() | Protein automated matches [190674] (25 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [271176] (2 PDB entries) |
![]() | Domain d2mg4b1: 2mg4 B:1-58 [271178] Other proteins in same PDB: d2mg4a2, d2mg4b2 automated match to d3zoba_ |
PDB Entry: 2mg4 (more details)
SCOPe Domain Sequences for d2mg4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mg4b1 a.4.1.0 (B:1-58) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} mekrprtefseeqkkaldlafyfdrrltpewrrylsqrlglneeqierwfrrkeqqig
Timeline for d2mg4b1: