SCOPe 2.08: Domain d4cx9a_: 4cx9 A:

Lineage for d4cx9a_ (4cx9 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.0: automated matches [271165] (1 protein)
   not a true family

6. Protein automated matches [271167] (4 species)
   not a true protein

7. Species Shewanella frigidimarina [TaxId:56812] [271169] (2 PDB entries)

8. Domain d4cx9a_: 4cx9 A: [271171]
   automated match to d2xlea_
   complexed with gol, hec, no, so4

Details for d4cx9a_

PDB Entry: 4cx9, 1.43 Å

PDB Description: the 5-coordinate proximal no complex of cytochrome c prime from shewanella frigidimarina

PDB Compounds: (A:) cytochrome c, class II

SCOPe Domain Sequences for d4cx9a_:

Sequence; same for both SEQRES and ATOM records:

>d4cx9a_ a.24.3.0 (A:) automated matches {Shewanella frigidimarina [TaxId: 56812]}
nfeepadaieyrqaafgliaynfgdmgamlkgkkpfdaavfstradnvaalskiphegfi
agsdkgdtealakiwqdkadfdskmtafqdnaaalavaakssdqnnikqafantgksckg
chdvykkd

Timeline for d4cx9a_:

• d4cx9a_ first appeared in SCOPe 2.05
  
• d4cx9a_ appears in SCOPe 2.07