Lineage for d1bsya_ (1bsy A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1799772Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1799795Protein beta-Lactoglobulin [50827] (4 species)
  7. 1799796Species Cow (Bos taurus) [TaxId:9913] [50828] (44 PDB entries)
    Uniprot P02754
  8. 1799819Domain d1bsya_: 1bsy A: [27117]

Details for d1bsya_

PDB Entry: 1bsy (more details), 2.24 Å

PDB Description: structural basis of the tanford transition of bovine beta-lactoglobulin from crystal structures at three ph values; ph 7.1
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d1bsya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsya_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOPe Domain Coordinates for d1bsya_:

Click to download the PDB-style file with coordinates for d1bsya_.
(The format of our PDB-style files is described here.)

Timeline for d1bsya_: