SCOPe 2.01: Domain d1bsya_: 1bsy A:

Lineage for d1bsya_ (1bsy A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (31 PDB entries)
   Uniprot P02754

8. Domain d1bsya_: 1bsy A: [27117]

Details for d1bsya_

PDB Entry: 1bsy, 2.24 Å

PDB Description: structural basis of the tanford transition of bovine beta-lactoglobulin from crystal structures at three ph values; ph 7.1

PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d1bsya_:

Sequence; same for both SEQRES and ATOM records:

>d1bsya_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

Timeline for d1bsya_:

• d1bsya_ first appeared (with stable ids) in SCOP 1.55, called d1bsy__
  
• d1bsya_ appears in SCOP 1.75
  
• d1bsya_ appears in SCOPe 2.02
  
• d1bsya_ appears in the current release, SCOPe 2.08