Lineage for d1bebb_ (1beb B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 564341Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 564342Superfamily b.60.1: Lipocalins [50814] (5 families) (S)
    bind hydrophobic ligands in their interior
  5. 564343Family b.60.1.1: Retinol binding protein-like [50815] (19 proteins)
    barrel, closed; n=8, S=12, meander
  6. 564366Protein beta-Lactoglobulin [50827] (2 species)
  7. 564367Species Cow (Bos taurus) [TaxId:9913] [50828] (16 PDB entries)
  8. 564369Domain d1bebb_: 1beb B: [27116]
    complexed with so4

Details for d1bebb_

PDB Entry: 1beb (more details), 1.8 Å

PDB Description: bovine beta-lactoglobulin, lattice x

SCOP Domain Sequences for d1bebb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bebb_ b.60.1.1 (B:) beta-Lactoglobulin {Cow (Bos taurus)}
qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkweng
ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcqclvr
tpevddealekfdkalkalpmhirlsfnptqleeqc

SCOP Domain Coordinates for d1bebb_:

Click to download the PDB-style file with coordinates for d1bebb_.
(The format of our PDB-style files is described here.)

Timeline for d1bebb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1beba_