Lineage for d4ytjf_ (4ytj F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867675Species Micromonospora echinospora [TaxId:1877] [257603] (5 PDB entries)
  8. 1867705Domain d4ytjf_: 4ytj F: [271153]
    automated match to d1mdza_
    complexed with so4, t6k, tyd

Details for d4ytjf_

PDB Entry: 4ytj (more details), 2.47 Å

PDB Description: crystal structure of sugar aminotransferase cals13 from micromonospora echinospora
PDB Compounds: (F:) CalS13

SCOPe Domain Sequences for d4ytjf_:

Sequence, based on SEQRES records: (download)

>d4ytjf_ c.67.1.0 (F:) automated matches {Micromonospora echinospora [TaxId: 1877]}
miplskvamspdvstrvsavlssgrlehgptvaeyeaavgsrignprvvsvncgtaglhl
alslaarpgagesehdgpgevlttpltfegtnwpilanglrirwvdvdpatlnmdlddla
akispatraivvvhwlgypvdlnrlravvdratagydrrplvvedcaqawgatyrgaplg
thgnvcvystgaikilttgsggfvvlpdddlydrlrlrrwlgierasdritgdydvaewg
yrfilneiggaiglsnlervdellrrhrenaafydkelagidgveqteraddrepafwmy
plkvrdrpafmrrlldagiatsvvsrrndahscvasarttlpgldrvadrvvhipvgwwl
teddrshvvetiksgw

Sequence, based on observed residues (ATOM records): (download)

>d4ytjf_ c.67.1.0 (F:) automated matches {Micromonospora echinospora [TaxId: 1877]}
miplskvamspdvstrvsavlssgrlehgptvaeyeaavgsrignprvvsvncgtaglhl
alslaarpgapgevlttpltfegtnwpilanglrirwvdvdpatlnmdlddlaakispat
raivvvhwlgypvdlnrlravvdratagydrrplvvedcaqawgatyrgaplgthgnvcv
ystgaikilttgsggfvvlpdddlydrlrlrrwlgierasdritgdydvaewgyrfilne
iggaiglsnlervdellrrhrenaafydkelagidgveqteraddrepafwmyplkvrdr
pafmrrlldagiatsvvsrrndahscvasarttlpgldrvadrvvhipvgwwlteddrsh
vvetiksgw

SCOPe Domain Coordinates for d4ytjf_:

Click to download the PDB-style file with coordinates for d4ytjf_.
(The format of our PDB-style files is described here.)

Timeline for d4ytjf_:

  • d4ytjf_ is new in SCOPe 2.05-stable
  • d4ytjf_ does not appear in SCOPe 2.06