Lineage for d4yrua_ (4yru A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1995633Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1995634Protein automated matches [190513] (30 species)
    not a true protein
  7. 1995772Species Norway rat (Rattus norvegicus) [TaxId:10116] [238064] (3 PDB entries)
  8. 1995779Domain d4yrua_: 4yru A: [271146]
    automated match to d1ikua_
    complexed with ca

Details for d4yrua_

PDB Entry: 4yru (more details), 2.8 Å

PDB Description: crystal structure of c-terminally truncated neuronal calcium sensor (ncs-1) from rattus norvegicus
PDB Compounds: (A:) neuronal calcium sensor 1

SCOPe Domain Sequences for d4yrua_:

Sequence, based on SEQRES records: (download)

>d4yrua_ a.39.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpfgdptkfatfvfnvfden
kdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivdaiyqmvgnt
velpeeentpekrvdrifammdknadgkltlqefqegsk

Sequence, based on observed residues (ATOM records): (download)

>d4yrua_ a.39.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpfgdptkfatfvfnvfden
kdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivdaiyqmvgnt
tpekrvdrifammdknadgkltlqefqegsk

SCOPe Domain Coordinates for d4yrua_:

Click to download the PDB-style file with coordinates for d4yrua_.
(The format of our PDB-style files is described here.)

Timeline for d4yrua_: